PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000259898
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 538aa    MW: 61742 Da    PI: 9.1433
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000259898genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.61.4e-182168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll+++++++G g+W++ a++ g++Rt+k+c++rw++yl
    MDP0000259898 21 RGPWTLEEDSLLIQYIARHGEGRWNLLAKRSGLRRTGKSCRLRWLNYL 68
                     89********************************************97 PP

2Myb_DNA-binding51.91.7e-1674117146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ ++eE++l++d++ ++G++ W++Ia++++ gRt++++k++w++
    MDP0000259898  74 RGNLSPEEQLLILDLHSKMGNR-WSKIAQYLP-GRTDNEIKNYWRT 117
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.9131668IPR017930Myb domain
SuperFamilySSF466895.62E-3119115IPR009057Homeodomain-like
SMARTSM007171.4E-162070IPR001005SANT/Myb domain
PfamPF002494.0E-172168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-232275IPR009057Homeodomain-like
CDDcd001671.88E-122368No hitNo description
PROSITE patternPS0017503645IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129425.19369123IPR017930Myb domain
SMARTSM007173.2E-1573121IPR001005SANT/Myb domain
PfamPF002494.6E-1574117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2376122IPR009057Homeodomain-like
CDDcd001672.19E-1178117No hitNo description
PfamPF012512.7E-77354534IPR000554Ribosomal protein S7e
PROSITE patternPS009480426439IPR000554Ribosomal protein S7e
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006412Biological Processtranslation
GO:0005618Cellular Componentcell wall
GO:0005886Cellular Componentplasma membrane
GO:0009507Cellular Componentchloroplast
GO:0022627Cellular Componentcytosolic small ribosomal subunit
GO:0003677Molecular FunctionDNA binding
GO:0003735Molecular Functionstructural constituent of ribosome
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MSTKTKTLSS SSGEDDGELR RGPWTLEEDS LLIQYIARHG EGRWNLLAKR SGLRRTGKSC  60
RLRWLNYLKP DVKRGNLSPE EQLLILDLHS KMGNRWSKIA QYLPGRTDNE IKNYWRTRVQ  120
KQARHLRIDT SSVEFQNMIR CYWMPRLQQK IGGEISTSSA VLNQNHTISQ PLEQNTFPHF  180
TATISPPPQI LVQEEINMSA TMYNLDVEKQ NTKAEYCTGP YIFPSEPMDM SKTVQFPECP  240
PFHCGDNNGY DTESFNLQET VSADSAPNFP GNCASDCYVA ETNWFDSDLL CSIWNTDEIL  300
SSRFLHFRFY FREGFSIPAE ARALGFSATQ KQKSLRLSIL LESDLAKMYT SRKKISKDNN  360
AEPTEFEESV AQAVFDLENT NQELKSDLKD LYINSAIQVD VSGSKKAVVI HVPYRLRKAY  420
RKIHVRLVRE LEKKFSGKDV ILIATRRIVR PPKKGSAAQX PRTRTLTAVH EAMLEDVVLP  480
AEIIGKRIRY RLDGSKIMKV FLDPKERNNT EYKLESFSAV YRKLSGKDVV FEYPITEA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4v7e_BH1e-108351537118740S ribosomal protein S7E
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.37140.0bud| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2678990.0DQ267899.1 Malus x domestica cultivar Royal Gala MYB8 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008367580.10.0PREDICTED: transcription factor MYB108-like
TrEMBLQ0QMQ90.0Q0QMQ9_MALDO; MYB8
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.12e-71myb domain protein 62